PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678326083
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family TALE
Protein Properties Length: 388aa    MW: 43603.3 Da    PI: 6.3101
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678326083genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox23.69e-083243572154
                HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
   Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                k +yp++e++++L +++gL+ +q+ +WF N+R +
  678326083 324 KWPYPTEEDKARLVQETGLQLKQINNWFINQRKR 357
                569*****************************87 PP

2ELK29.41.8e-10278299122
        ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                ELKh+L+++Y+ +++++++E++
  678326083 278 ELKHELKQGYKDKIVDIREEIL 299
                9*******************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012552.6E-20112156IPR005540KNOX1
PfamPF037901.5E-17114155IPR005540KNOX1
SMARTSM012564.8E-25165221IPR005541KNOX2
PfamPF037911.0E-17171220IPR005541KNOX2
PROSITE profilePS512139.969278298IPR005539ELK domain
SMARTSM011885.1E-4278299IPR005539ELK domain
PfamPF037891.3E-5278299IPR005539ELK domain
PROSITE profilePS5007111.677298361IPR001356Homeobox domain
SuperFamilySSF466894.71E-16300364IPR009057Homeodomain-like
SMARTSM003893.5E-11300365IPR001356Homeobox domain
CDDcd000867.74E-12301360No hitNo description
Gene3DG3DSA:1.10.10.602.5E-25305362IPR009057Homeodomain-like
PfamPF059204.5E-18318357IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 388 aa     Download sequence    Send to blast
MAFQDHHHLP REMPIHYAAD PSTAQPSVFR SMIPDHRHSP DDKQQQPTTT TAWLNNAAVL  60
HHQWLPTTQS QPSPNSNSPR DKPDHQLHDA GPGPGGDADN SSGGGGTNWE REKCKADILN  120
HPLYEELLSA HVACLRIATP VDQLPRIDAQ LAQSQQVVAK YSVFGHGQPP LDEKDLDHFM  180
THYVLLLSSF KEQLQQHVRV HAMEAVMACW ELEQSLQSLT GVAPGEGSGA TMSDDDEDQA  240
DSDTNLFDES FDGSDSMGFG PLVPTESERS LMERVRQELK HELKQGYKDK IVDIREEILR  300
KRRAGKLPGD TTSVLKAWWQ AHSKWPYPTE EDKARLVQET GLQLKQINNW FINQRKRNWH  360
SNPSSSSSQK SKRKSGEGGK TSANEHYV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1x2n_A1e-12301365872Homeobox protein PKNOX1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011084049.10.0PREDICTED: homeobox protein knotted-1-like LET12 isoform X1
SwissprotO223001e-169LET12_SOLLC; Homeobox protein knotted-1-like LET12
TrEMBLS8CZT10.0S8CZT1_9LAMI; Uncharacterized protein (Fragment)
TrEMBLA0A022QCD31e-179A0A022QCD3_ERYGU; Uncharacterized protein
STRINGVIT_04s0008g06130.t011e-176(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA14322472
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G11060.11e-149KNOTTED1-like homeobox gene 4